PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G438800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 150aa    MW: 16574.6 Da    PI: 4.6175
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G438800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.21.3e-0630652863
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1 28 ieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                         e+L  +vkeL++   +L +++++lk+ev++ +s+v
  Sevir.2G438800.3.p 30 FEQLDARVKELTSSQAELLERIQKLKQEVQNWRSNV 65
                        58****************************998876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MAAESTAPPP PSLPPPATAA APRHPRLLGF EQLDARVKEL TSSQAELLER IQKLKQEVQN  60
WRSNVETQVR TCQNELQGLK KGLDSEVEQL KLEMKEIRSA IQKEKGNLPT QITTLEMSNN  120
DTEQALQTQD QALKVDTDAS MEEQTATQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9641851e-107EU964185.1 Zea mays clone 276545 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958637.12e-86PREDICTED: uncharacterized protein LOC101759545 isoform X1
TrEMBLK3ZXR72e-86K3ZXR7_SETIT; Uncharacterized protein
STRINGSi031399m7e-86(Setaria italica)